Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5)

This Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5) spans the amino acid sequence from region 35-685aa (E398K) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carcinoembryonic antigen (CEA) (Meconium antigen 100) (CD66e)

UniProt

P06731

Expression Region

35-685aa (E398K)

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pig IgG (H&L) Biotin Antibody
orb734541-01 100 µL

Mouse Pig IgG (H&L) Biotin Antibody

Sign In for Pricing
View Details
Mouse Pig IgG (H&L) Biotin Antibody
orb734541-02 500 μL

Mouse Pig IgG (H&L) Biotin Antibody

Sign In for Pricing
View Details
Mouse Pig IgG (H&L) Biotin Antibody
orb734541-03 1 mL

Mouse Pig IgG (H&L) Biotin Antibody

Sign In for Pricing
View Details
CRTC2 antibody
FNab01998 100 µg

CRTC2 antibody

Sign In for Pricing
View Details
Hspb3 AAV siRNA Pooled Vector
24019164 1.0 µg

Hspb3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Dibutyl fumarate
D11700-01 500 g

Dibutyl fumarate

Sign In for Pricing
View Details