Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vascular endothelial growth factor A (VEGFA)

This Recombinant Human Vascular endothelial growth factor A (VEGFA) spans the amino acid sequence from region 27-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vascular permeability factor (VPF)

UniProt

P15692

Expression Region

27-232aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PFDN4 Protein, His, E.coli-2ug
QP13016-2ug 2ug

Recombinant Human PFDN4 Protein, His, E.coli-2ug

Sign In for Pricing
View Details
FGF13 Human qPCR Template Standard (NM_004114)
HK209439 1 Kit

FGF13 Human qPCR Template Standard (NM_004114)

Sign In for Pricing
View Details
Anti-SAA1 antibody
STJ400173 1 mg

Anti-SAA1 antibody

Sign In for Pricing
View Details
Neurofilament (NEFH, Neurofilament H, Neurofilament Heavy Polypeptide 200kD, Neurofilament Triplet H Protein, NF-H, NF200, NF-H) (Biotin)
MBS6124404-01 0.1 mL

Neurofilament (NEFH, Neurofilament H, Neurofilament Heavy Polypeptide 200kD, Neurofilament Triplet H Protein, NF-H, NF200, NF-H) (Biotin)

Sign In for Pricing
View Details
Neurofilament (NEFH, Neurofilament H, Neurofilament Heavy Polypeptide 200kD, Neurofilament Triplet H Protein, NF-H, NF200, NF-H) (Biotin)
MBS6124404-02 5x 0.1 mL

Neurofilament (NEFH, Neurofilament H, Neurofilament Heavy Polypeptide 200kD, Neurofilament Triplet H Protein, NF-H, NF200, NF-H) (Biotin)

Sign In for Pricing
View Details
Rat Homeobox Protein CDX-1 (CDX1) ELISA Kit
MBS9347670-01 48 Well

Rat Homeobox Protein CDX-1 (CDX1) ELISA Kit

Sign In for Pricing
View Details