Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Natriuretic peptides A (NPPA), partial

This Recombinant Human Natriuretic peptides A (NPPA), partial spans the amino acid sequence from region 78-115aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CDD-ANF (Cardiodilatin) (CDD) (Cardiodilatin-related peptide) (CDP)

UniProt

P01160

Expression Region

78-115aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

5.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Lactoferrin Antibody
RC-16025-01 50 μL

Recombinant Lactoferrin Antibody

Sign In for Pricing
View Details
Recombinant Lactoferrin Antibody
RC-16025-02 100 µL

Recombinant Lactoferrin Antibody

Sign In for Pricing
View Details
Recombinant Lactoferrin Antibody
RC-16025-03 1 mL

Recombinant Lactoferrin Antibody

Sign In for Pricing
View Details
ZNF276 (NM_001113525) Human Over-expression Lysate
LC426428 20 µg

ZNF276 (NM_001113525) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS704118 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Human ZNF10 activation kit by CRISPRa
GA105203 1 Kit

Human ZNF10 activation kit by CRISPRa

Sign In for Pricing
View Details