Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cobalamin binding intrinsic factor (CBLIF)

This Recombinant Human Cobalamin binding intrinsic factor (CBLIF) spans the amino acid sequence from region 19-417aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gastric intrinsic factor1 Publication

UniProt

P27352

Expression Region

19-417aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMARCA2/BRM Mouse Monoclonal Antibody (Fluoro594)
orb3085032 100 µg

SMARCA2/BRM Mouse Monoclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Clobazam Impurity 1
CS-T-96098 1 Each

Clobazam Impurity 1

Sign In for Pricing
View Details
TRA2B Rabbit Polyclonal Antibody
TA359795 100 µL

TRA2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Gpatch3 qPCR Primer Pair
QM63154S 200 Tests

Mouse Gpatch3 qPCR Primer Pair

Sign In for Pricing
View Details
BNIP3L CRISPR Knock Out 293T Cell Line (Human)
13395141 1x 10^6 Cells / 1.0 mL

BNIP3L CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
XIAP (A-7) : m-IgGκ BP-HRP Bundle
sc-521015 1 Kit

XIAP (A-7) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details