Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gastrin-releasing peptide (GRP), partial

This Recombinant Human Gastrin-releasing peptide (GRP), partial spans the amino acid sequence from region 54-121aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P07492

Expression Region

54-121aa

Tag

N-terminal GST-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTC (Betacellulin) (AP)
MBS6408907-01 0.1 mL

BTC (Betacellulin) (AP)

Sign In for Pricing
View Details
BTC (Betacellulin) (AP)
MBS6408907-02 5x 0.1 mL

BTC (Betacellulin) (AP)

Sign In for Pricing
View Details
JNK1 + JNK3 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-0501R-BF680-TR 20 µL

JNK1 + JNK3 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
HINT3, NT (HINT3, Histidine triad nucleotide-binding protein 3) (MaxLight 750) discontinued
036560-ML750 100 µL

HINT3, NT (HINT3, Histidine triad nucleotide-binding protein 3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Human Protein mono-ADP-ribosyltransferase PARP14 (PARP14), partial
CSB-BP677190HU-01 20 µg

Recombinant Human Protein mono-ADP-ribosyltransferase PARP14 (PARP14), partial

Sign In for Pricing
View Details
Recombinant Human Protein mono-ADP-ribosyltransferase PARP14 (PARP14), partial
CSB-BP677190HU-02 100 µg

Recombinant Human Protein mono-ADP-ribosyltransferase PARP14 (PARP14), partial

Sign In for Pricing
View Details