Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2), partial

This Recombinant Human Gamma-aminobutyric acid receptor subunit beta-2 (GABRB2), partial spans the amino acid sequence from region 26-244aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GABA (A) receptor subunit beta-2

UniProt

P47870

Expression Region

26-244aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAT8L Antibody
OACD00969-100UL 100 µL

NAT8L Antibody

Sign In for Pricing
View Details
MPO, CT (MPO, Myeloperoxidase, 89kD myeloperoxidase, 84kD myeloperoxidase, Myeloperoxidase light chain, Myeloperoxidase heavy chain) (MaxLight 550) discontinued
038563-ML550 100 µL

MPO, CT (MPO, Myeloperoxidase, 89kD myeloperoxidase, 84kD myeloperoxidase, Myeloperoxidase light chain, Myeloperoxidase heavy chain) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Human oxLDL, His Tag
E24PHA436 50 µg

Human oxLDL, His Tag

Sign In for Pricing
View Details
Syndecan 3
S9111-50A 100 µg

Syndecan 3

Sign In for Pricing
View Details
Recombinant Human Thymic Stromal Lymphopoietin
7-01684 5 µg

Recombinant Human Thymic Stromal Lymphopoietin

Sign In for Pricing
View Details
Agfg2 (NM_145566) Mouse Tagged Lenti ORF Clone
MR203963L4 10 µg

Agfg2 (NM_145566) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details