Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial
This Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial spans the amino acid sequence from region 248-360aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Heparin-binding protein 44 (HBP-44) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP)
UniProt
P55302
Expression Region
248-360aa
Tag
N-terminal GFP-tagged and C-terminal 6xHis-tagged
Source
Baculovirus
Origin
Mus musculus (Mouse)
Field of Research
Cell Biology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
42.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
45409141 1x 10^6 Cells / 1.0 mL
SPSB2 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details 
N2100-010 10 Preparations
NC Protein extraction Kit (10) , Nuclear & Cytoplasmic
Sign In for Pricing
View Details 033069-ML550 100 µL
C9JLR9, CT (C11orf95, Uncharacterized protein C11orf95) (MaxLight 550) discontinued
Sign In for Pricing
View Details