Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Group 10 secretory phospholipase A2 (Pla2g10)

This Recombinant Mouse Group 10 secretory phospholipase A2 (Pla2g10) spans the amino acid sequence from region 29-151aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Group X secretory phospholipase A2 (GX sPLA2) (sPLA2-X) (Phosphatidylcholine 2-acylhydrolase 10)

UniProt

Q9QXX3

Expression Region

29-151aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWCCYHHDCCYSRAQDAGCSPKLDRYPWKCMDHHILCGPAENKCQELLCRCDEELAYCLAGTEYHLKYLFFPSILCEKDSPKCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC7A5 Polyclonal Antibody, Biotin Conjugated
bs-10125R-Biotin 100 µL

SLC7A5 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
PTPN6 Antibody, Biotin conjugated
CSB-PA019043HD01HU-01 50 µg

PTPN6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PTPN6 Antibody, Biotin conjugated
CSB-PA019043HD01HU-02 100 µg

PTPN6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Snaclec rhodocytin subunit beta Recombinant Protein (Agkistrodon rhodostoma)
OPCA05154-20UG 20 µg

Snaclec rhodocytin subunit beta Recombinant Protein (Agkistrodon rhodostoma)

Sign In for Pricing
View Details
1-[2- (2,6-dichloro-4-pyridyl) -1,3-thiazol-4-yl]ethan-1-one 1- (2,6-dichlorophenyl) hydrazone
OR29733 1 Each

1-[2- (2,6-dichloro-4-pyridyl) -1,3-thiazol-4-yl]ethan-1-one 1- (2,6-dichlorophenyl) hydrazone

Sign In for Pricing
View Details
H1f4 (NM_015787) Mouse Untagged Clone
MC209859 10 µg

H1f4 (NM_015787) Mouse Untagged Clone

Sign In for Pricing
View Details