Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia rickettsii 17 kDa surface antigen (omp)

This Recombinant Rickettsia rickettsii 17 kDa surface antigen (omp) spans the amino acid sequence from region 20-159aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P0A3N5

Expression Region

20-159aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Rickettsia rickettsii

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGKGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ANKRD53 Antibody (OTI1E1) [mFluor Violet 450 SE]
NBP2-72217MFV450 0.1 mL

Mouse Monoclonal ANKRD53 Antibody (OTI1E1) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
FABP3 Rabbit Polyclonal Antibody
E28PB2920 100 µL

FABP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NRAS Rabbit Polyclonal Antibody (PE)
orb2818405 100 µg

NRAS Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
ATP2B2 (NM_001001331) Human Mass Spec Standard
PH321710 10 µg

ATP2B2 (NM_001001331) Human Mass Spec Standard

Sign In for Pricing
View Details
Phospho-POLR2A (S5) Recombinant Rabbit Monoclonal Antibody [JM51-21]
ET1703-87 100 µL

Phospho-POLR2A (S5) Recombinant Rabbit Monoclonal Antibody [JM51-21]

Sign In for Pricing
View Details
CD154, NT (CD40 Ligand, CD40-L, CD40L, CD40LG, gp39, hCD40L, HIGM1, IGM, IMD3, T-BAM, T-cell Antigen GP39, TNF-related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, TNF Ligand Superfamily Member 5, TNFSF5) (AP)
MBS6468049-01 0.2 mL

CD154, NT (CD40 Ligand, CD40-L, CD40L, CD40LG, gp39, hCD40L, HIGM1, IGM, IMD3, T-BAM, T-cell Antigen GP39, TNF-related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, TNF Ligand Superfamily Member 5, TNFSF5) (AP)

Sign In for Pricing
View Details