Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Crotalus atrox Snake venom serine protease catroxase-2

This Recombinant Crotalus atrox Snake venom serine protease catroxase-2 spans the amino acid sequence from region 25-258aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Catroxase II (Kallikrein-like EI)

UniProt

Q8QHK2

Expression Region

25-258aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Crotalus atrox (Western diamondback rattlesnake)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVGGDECNINEHRSLVAIFNSTEFFCSGTLINQEWVVTAAHCDSTNFKMKLGVHSKKVPNEDEQTRNPKEKFFCPNKKKDDVLDKDIMLIKLDSPVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEKTLPDVPYCANIKLLDDAVCQPPYPELPATSRTLCAGIPEGGKDTCGGDSGGPLICNGQFQGIVFYGAHPCGQALKPGVYTKVFDYNDWIQSIIAGNTAATCPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Slc25a17 shRNA (UAS) - Lentiviral mouse Slc25a17 shRNA (UAS, iRFP) (100)
GTR15272055 1 Vial

Lentiviral mouse Slc25a17 shRNA (UAS) - Lentiviral mouse Slc25a17 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
S100A14 Rabbit Polyclonal Antibody (Fluoro550)
orb3102088 100 µg

S100A14 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Mouse RXFP1 siRNA
abx932315-01 15 nmol

Mouse RXFP1 siRNA

Sign In for Pricing
View Details
Mouse RXFP1 siRNA
abx932315-02 30 nmol

Mouse RXFP1 siRNA

Sign In for Pricing
View Details
BST2 (Bone Marrow Stromal Antigen 2, BST-2, HM1.24 Antigen, Tetherin, CD317) (Biotin)
124026-Biotin 100 µL

BST2 (Bone Marrow Stromal Antigen 2, BST-2, HM1.24 Antigen, Tetherin, CD317) (Biotin)

Sign In for Pricing
View Details
Mix-1 Antibody
orb800990 2 mg

Mix-1 Antibody

Sign In for Pricing
View Details