Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial (Active)

1 Measured by its binding ability in a functional ELISA.Immobilized Human TREM2 at 2 μg/mL can bind Anti-TREM2 recombinant antibody. The EC50 is 1.145-1.358 ng/mL. 2 TREM2 Recombinant Monoclonal Antibody captured on Protein A Chip can bind Recombinant Human TREM2 with an affinity constant of 0.146 nM as detected by TREM2aSPR Assay.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS