Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Phospholipase A2 group XV (PLA2G15)

This Recombinant Dog Phospholipase A2 group XV (PLA2G15) spans the amino acid sequence from region 32-408aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1-O-acylceramide synthase1 (ACS1) (LCAT-like lysophospholipase1) (LLPL1) (Lysophospholipase 3) (Lysosomal phospholipase A2) (LPLA2)

UniProt

Q6XPZ3

Expression Region

32-408aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RRPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKRTESYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVDWGYIRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGDNNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANYTLRDYHQFFQDIGFKDGWLMRQDTEGLVEAMVPPGVPLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLQSALQCQAWRGHQEHQVSLQALPGSEHIEMLANATTLAYLKRVLLGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Thrombopoietin (TPO) ELISA Kit
RDR-TPO-Hu-01 96 Tests

Human Thrombopoietin (TPO) ELISA Kit

Sign In for Pricing
View Details
Human Thrombopoietin (TPO) ELISA Kit
RDR-TPO-Hu-02 48 Tests

Human Thrombopoietin (TPO) ELISA Kit

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (KLK3/2871R), 0.2mg/mL
BNUB2871-500 1x 500 µL

Prostate Specific Antigen (PSA) (KLK3/2871R), 0.2mg/mL

Sign In for Pricing
View Details
2-Hydroxyethanesulfonic Acid (80% w/w in Water)
TRC-H553395-50G 50 g

2-Hydroxyethanesulfonic Acid (80% w/w in Water)

Sign In for Pricing
View Details
HSP90AA1 Mouse Monoclonal Antibody [Clone ID: MBH90AB]
AM26034PU-N 100 µg

HSP90AA1 Mouse Monoclonal Antibody [Clone ID: MBH90AB]

Sign In for Pricing
View Details
Myclobutanil
TRC-M831400-250MG 250 mg

Myclobutanil

Sign In for Pricing
View Details