Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Phospholipase A2 group XV (PLA2G15)

This Recombinant Dog Phospholipase A2 group XV (PLA2G15) spans the amino acid sequence from region 32-408aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1-O-acylceramide synthase1 (ACS1) (LCAT-like lysophospholipase1) (LLPL1) (Lysophospholipase 3) (Lysosomal phospholipase A2) (LPLA2)

UniProt

Q6XPZ3

Expression Region

32-408aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RRPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKRTESYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVDWGYIRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGDNNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANYTLRDYHQFFQDIGFKDGWLMRQDTEGLVEAMVPPGVPLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLQSALQCQAWRGHQEHQVSLQALPGSEHIEMLANATTLAYLKRVLLGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIR3DL2 (NM_006737) Human Tagged ORF Clone
RG220916 10 µg

KIR3DL2 (NM_006737) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human Granzyme B ELISA Kit
MBS824980-01 96 Tests

Human Granzyme B ELISA Kit

Sign In for Pricing
View Details
Human Granzyme B ELISA Kit
MBS824980-02 5x 96 Tests

Human Granzyme B ELISA Kit

Sign In for Pricing
View Details
USP45 Rabbit Polyclonal Antibody
E10G01990 100 µL

USP45 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC16A4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43900061 1.0 µg DNA

SLC16A4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
DLL4 Human shRNA Lentiviral Particle (Locus ID 54567)
TL304977V 500 µL Each

DLL4 Human shRNA Lentiviral Particle (Locus ID 54567)

Sign In for Pricing
View Details