Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Azurocidin (AZU1)

This Recombinant Human Azurocidin (CAP7) spans the amino acid sequence from region 27-248. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cationic antimicrobial protein CAP371 Publication (Heparin-binding protein1 Publication) (HBP1 Publication) (hHBP1 Publication)

UniProt

P20160

Expression Region

27-248aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MT-CO3 AAV siRNA Pooled Vector
30779161 1.0 µg

MT-CO3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
GSK461364 500mg
A10442-500 500 mg

GSK461364 500mg

Sign In for Pricing
View Details
Polyclonal Antibody to Gelsolin (GS)
MBS2028809-01 0.1 mL

Polyclonal Antibody to Gelsolin (GS)

Sign In for Pricing
View Details
Polyclonal Antibody to Gelsolin (GS)
MBS2028809-02 0.2 mL

Polyclonal Antibody to Gelsolin (GS)

Sign In for Pricing
View Details
Polyclonal Antibody to Gelsolin (GS)
MBS2028809-03 0.5 mL

Polyclonal Antibody to Gelsolin (GS)

Sign In for Pricing
View Details
Polyclonal Antibody to Gelsolin (GS)
MBS2028809-04 1 mL

Polyclonal Antibody to Gelsolin (GS)

Sign In for Pricing
View Details