Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tripeptidyl-peptidase 2 (Tpp2), partial

This Recombinant Mouse Tripeptidyl-peptidase 2 (Tpp2), partial spans the amino acid sequence from region 44-264aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tripeptidyl aminopeptidase (Tripeptidyl-peptidase II) (TPP-II)

UniProt

Q64514

Expression Region

44-264aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPM4 Rabbit Polyclonal Antibody
TA382758 100 µL

TPM4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Remimazolam
TRC-R143600-1MG 1 mg

Remimazolam

Sign In for Pricing
View Details
Relaxin 2 (RLN2) Rabbit Polyclonal Antibody
AP02205SU-S 20 µL

Relaxin 2 (RLN2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PITX1 Antibody
8C10791-AAT 50 µg

PITX1 Antibody

Sign In for Pricing
View Details
Serum Amyloid A (SAA1) Human Gene Knockout Kit (CRISPR)
KN402738 1 Kit

Serum Amyloid A (SAA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(3aR,4R,5R,6aS)-Hexahydro-2-oxo-4-[(1E)-3-oxo-1-octen-1-yl]-2H-cyclopenta[b]furan-5-yl Ester [1,1’-Biphenyl]-4-carboxylic Acid
TRC-H294375-1G 1 g

(3aR,4R,5R,6aS)-Hexahydro-2-oxo-4-[(1E)-3-oxo-1-octen-1-yl]-2H-cyclopenta[b]furan-5-yl Ester [1,1’-Biphenyl]-4-carboxylic Acid

Sign In for Pricing
View Details