Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tripeptidyl-peptidase 2 (Tpp2), partial

This Recombinant Mouse Tripeptidyl-peptidase 2 (Tpp2), partial spans the amino acid sequence from region 44-264aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tripeptidyl aminopeptidase (Tripeptidyl-peptidase II) (TPP-II)

UniProt

Q64514

Expression Region

44-264aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human URP2 (FERMT3) activation kit by CRISPRa
GA113243 1 Kit

Human URP2 (FERMT3) activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgM Immunoglobulin (DA4-4), CF405S conjugate, 0.1mg/mL
BNC040759-500 1x 500 µL

Human IgM Immunoglobulin (DA4-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant AKR1B1 Monoclonal Antibody
AN300120P 100 µL

Recombinant AKR1B1 Monoclonal Antibody

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2121), Biotin conjugate, 0.1mg/mL
BNCB2121-100 1x 100 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2121), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant ATF2 (phospho T71) Antibody
RC-4303-01 50 μL

Recombinant ATF2 (phospho T71) Antibody

Sign In for Pricing
View Details
Recombinant ATF2 (phospho T71) Antibody
RC-4303-02 100 µL

Recombinant ATF2 (phospho T71) Antibody

Sign In for Pricing
View Details