Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inducible T-cell costimulator (ICOS), partial

This Recombinant Human Inducible T-cell costimulator (ICOS), partial spans the amino acid sequence from region 21-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activation-inducible lymphocyte immunomediatory molecule

UniProt

Q9Y6W8

Expression Region

21-141aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF13 (NM_033642) Human Recombinant Protein
TP317121 20 µg

FGF13 (NM_033642) Human Recombinant Protein

Sign In for Pricing
View Details
SYT5, GST-Tag, Recombinant (Synaptotagmin-5) discontinued
501036 200 µg

SYT5, GST-Tag, Recombinant (Synaptotagmin-5) discontinued

Sign In for Pricing
View Details
BMP-2-Inducible Protein Kinase (BMP2K) Antibody
abx148649-01 50 µg

BMP-2-Inducible Protein Kinase (BMP2K) Antibody

Sign In for Pricing
View Details
BMP-2-Inducible Protein Kinase (BMP2K) Antibody
abx148649-02 100 µg

BMP-2-Inducible Protein Kinase (BMP2K) Antibody

Sign In for Pricing
View Details
Apolipoprotein A1 Conjugated Antibody
orb1611687 100 µL

Apolipoprotein A1 Conjugated Antibody

Sign In for Pricing
View Details
Riiad1 Rat shRNA Plasmid (Locus ID 100270669)
TR709117 1 Kit

Riiad1 Rat shRNA Plasmid (Locus ID 100270669)

Sign In for Pricing
View Details