Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction alpha-1 protein (Gja1), partial

This Recombinant Mouse Gap junction alpha-1 protein (Gja1), partial spans the amino acid sequence from region 232-382aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Connexin-43 (Cx43) (Gap junction 43 kDa heart protein)

UniProt

P23242

Expression Region

232-382aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDSQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dystrophia myotonica protein kinase (DMPK) (NM_001081562) Human Over-expression Lysate
LC421165 20 µg

Dystrophia myotonica protein kinase (DMPK) (NM_001081562) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TSLP Recombinant Rabbit monoclonal Antibody
HA723492B 100 µL

Human TSLP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701085 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
EDG4 (LPAR2) Rabbit Polyclonal Antibody
AP01254PU-N 100 µg

EDG4 (LPAR2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS1-4), CF568 conjugate, 0.1mg/mL
BNC681745-500 1x 500 µL

Epstein-Barr Virus (LMP-1) (CS1-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SAPAP3 (DLGAP3) Mouse Monoclonal Antibody [Clone ID: OTI1D3]
CF811498 100 µg

SAPAP3 (DLGAP3) Mouse Monoclonal Antibody [Clone ID: OTI1D3]

Sign In for Pricing
View Details