Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 13A1 (OR13A1)

This Recombinant Human Olfactory receptor 13A1 (OR13A1) spans the amino acid sequence from region 1-328aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor OR10-3

UniProt

Q8NGR1

Expression Region

1-328aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKLWMESHLIVPETRPSPRMMSNQTLVTEFILQGFSEHPEYRVFLFSCFLFLYSGALTGNVLITLAITFNPGLHAPMYFFLLNLATMDIICTSSIMPKALASLVSEESSISYGGCMAQLYFLTWAASSELLLLTVMAYDRYAAICHPLHYSSMMSKVFCSGLATAVWLLCAVNTAIHTGLMLRLDFCGPNVIIHFFCEVPPLLLLSCSSTYVNGVMIVLADAFYGIVNFLMTIASYGFIVSSILKVKTAWGRQKAFSTCSSHLTVVCMYYTAVFYAYISPVSGYSAGKSKLAGLLYTVLSPTLNPLIYTLRNKEVKAALRKLFPFFRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RSPO3 Protein (Fc & His Tag)
PKSH033378-01 10 µg

Recombinant Human RSPO3 Protein (Fc & His Tag)

Sign In for Pricing
View Details
Recombinant Human RSPO3 Protein (Fc & His Tag)
PKSH033378-02 50 µg

Recombinant Human RSPO3 Protein (Fc & His Tag)

Sign In for Pricing
View Details
Human fucosyltransferase 8 (FUT8) ELISA Kit
YP-W79877-01 48 Tests

Human fucosyltransferase 8 (FUT8) ELISA Kit

Sign In for Pricing
View Details
Human fucosyltransferase 8 (FUT8) ELISA Kit
YP-W79877-02 96 Tests

Human fucosyltransferase 8 (FUT8) ELISA Kit

Sign In for Pricing
View Details
Clostridium perfringes serotype A
FR110 100 Reactions

Clostridium perfringes serotype A

Sign In for Pricing
View Details
STAT3 Polyclonal Antibody, RBITC Conjugated
bs-55208R-RBITC 100 µL

STAT3 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details