Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADPH oxidase 1 (NOX1)

This Recombinant Human NADPH oxidase 1 (NOX1) spans the amino acid sequence from region 1-564aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitogenic oxidase 1 (MOX-1) (NADH/NADPH mitogenic oxidase subunit P65-MOX) (NOH-1)

UniProt

Q9Y5S8

Expression Region

1-564aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL18P12 CRISPR Knock Out 293T Cell Line (Human)
40941141 1x 10^6 Cells / 1.0 mL

RPL18P12 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Fmoc-D-Phe-SASRIN resin (200-400 mesh, 0.4-0.7 mmol/g)
D-1770.0005 5.0g

Fmoc-D-Phe-SASRIN resin (200-400 mesh, 0.4-0.7 mmol/g)

Sign In for Pricing
View Details
IRF2BPL siRNA (Mouse)
MBS8229861-01 15 nmol

IRF2BPL siRNA (Mouse)

Sign In for Pricing
View Details
IRF2BPL siRNA (Mouse)
MBS8229861-02 30 nmol

IRF2BPL siRNA (Mouse)

Sign In for Pricing
View Details
IRF2BPL siRNA (Mouse)
MBS8229861-03 5x 30 nmol

IRF2BPL siRNA (Mouse)

Sign In for Pricing
View Details
Human/Mouse Brachyury Affinity Purified Polyclonal Ab
AF2085-SP 25 µg

Human/Mouse Brachyury Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details