Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADPH oxidase 1 (NOX1)

This Recombinant Human NADPH oxidase 1 (NOX1) spans the amino acid sequence from region 1-564aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitogenic oxidase 1 (MOX-1) (NADH/NADPH mitogenic oxidase subunit P65-MOX) (NOH-1)

UniProt

Q9Y5S8

Expression Region

1-564aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSG11 CRISPR Activation Plasmid (h2)
sc-417416-ACT-2 20 µg

PSG11 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
IGHD3OR15-3A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1029006 1.0 µg DNA

IGHD3OR15-3A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ITPK1 (NM_001142594) Human Tagged ORF Clone
RG227538 10 µg

ITPK1 (NM_001142594) Human Tagged ORF Clone

Sign In for Pricing
View Details
Raf Kinase Inhibitor V
sc-222241A 10 mg

Raf Kinase Inhibitor V

Sign In for Pricing
View Details
SRSF3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2807206 1.0 µg DNA

SRSF3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Gbx1 Rabbit Polyclonal Antibody (BF488)
orb1598680 100 µL

Gbx1 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details