Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Endoglucanase (eglS)

This Recombinant Bacillus subtilis Endoglucanase (eglS) spans the amino acid sequence from region 30-499aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carboxymethyl-cellulase, CMCase, Cellulase, Endo-1,4-beta-glucanase

UniProt

P10475

Expression Region

30-499aa

Tag

N-terminal 10xHis-tagged and C-terminal V5-tagged

Source

E.coli

Origin

Bacillus subtilis (strain 168)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGTKTPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSALKPGASKTGGWRLSDLSASGTFVRENILGTKDSTKDIPETPSKDKPTQENGISVQYRAGDGSMNSNQIRPQLQIKNNGNTTVDLKDVTARYWYKAKNKGQNFDCDYAQIGCGNVTHKFVTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHNDDWSNYAQSGDYSFFKSNTFKTTKKITLYDQGKLIWGTEPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4, Mouse (T-Cell Marker) (GK1.5), 0.2mg/mL
BNUB2009-500 1x 500 µL

CD4, Mouse (T-Cell Marker) (GK1.5), 0.2mg/mL

Sign In for Pricing
View Details
Zbed4 Mouse Gene Knockout Kit (CRISPR)
KN519586 1 Kit

Zbed4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ALDH5A1 (C-term) Rabbit Polyclonal Antibody
AP11469PU-N 400 µL

ALDH5A1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG76e), 1mg/mL
BNUM1687-50 1x 50 µL

VEGF (Vascular Endothelial Growth Factor) (VG76e), 1mg/mL

Sign In for Pricing
View Details
CASQ2 (NM_001232) Human Over-expression Lysate
LY400493 100 µg

CASQ2 (NM_001232) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Dectin 1 (CLEC7A) activation kit by CRISPRa
GA112091 1 Kit

Human Dectin 1 (CLEC7A) activation kit by CRISPRa

Sign In for Pricing
View Details