Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Retinoic acid-induced protein 3 (GPRC5A), partial

This Recombinant Human Retinoic acid-induced protein 3 (GPRC5A), partial spans the amino acid sequence from region 269-357aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G-protein coupled receptor family C group 5 member A, Phorbol ester induced gene 1, PEIG-1, Retinoic acid-induced gene 1 protein, RAIG-1

UniProt

Q8NFJ5

Expression Region

269-357aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EYA1 Protein Lysate
OCOA05262-20UG 20 µg

EYA1 Protein Lysate

Sign In for Pricing
View Details
Biotin anti-mouse CD45.2
E16FMB045.2-050U 50 µg

Biotin anti-mouse CD45.2

Sign In for Pricing
View Details
LRRF2, CT (Leucine-rich repeat flightless-interacting protein 2, LRR FLII-interacting protein 2, LRRFIP2) (Azide free) (HRP) discontinued
037977-HRP 200 µL

LRRF2, CT (Leucine-rich repeat flightless-interacting protein 2, LRR FLII-interacting protein 2, LRRFIP2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Human Merlin, NF2 ELISA Kit
MBS9331611-01 48 Well

Human Merlin, NF2 ELISA Kit

Sign In for Pricing
View Details
Human Merlin, NF2 ELISA Kit
MBS9331611-02 96 Well

Human Merlin, NF2 ELISA Kit

Sign In for Pricing
View Details
Human Merlin, NF2 ELISA Kit
MBS9331611-03 5x 96 Well

Human Merlin, NF2 ELISA Kit

Sign In for Pricing
View Details