Recombinant Escherichia coli O127:H6 Ecotin (eco)
This Recombinant Escherichia coli O127:H6 Ecotin (eco) spans the amino acid sequence from region 21-162aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
UniProt
B7UFM3
Expression Region
21-162aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Field of Research
Infectious Disease & Virology; Stem Cell & Developmental Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
23.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLESKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal TSH beta Antibody (TSH-116) [mFluor Violet 450 SE]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NB500-363MFV450 0.1 mL
Mouse Monoclonal TSH beta Antibody (TSH-116) [mFluor Violet 450 SE]
Sign In for Pricing
View Details 
K6598704 1.0 µg DNA
Tmem141 sgRNA CRISPR Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details