Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Dihydrofolate reductase (folA)

This Recombinant Staphylococcus aureus Dihydrofolate reductase (folA) spans the amino acid sequence from region 2-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DHFR

UniProt

P99079

Expression Region

2-159aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain N315)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ GDNF family receptor alpha-1 (Rat Gfra1) ELISA
KLR3885 96 Well

GENLISA™ GDNF family receptor alpha-1 (Rat Gfra1) ELISA

Sign In for Pricing
View Details
Mouse Vomeronasal type-2 receptor 1 (VMN2R1) ELISA Kit
abx552815 96 Tests

Mouse Vomeronasal type-2 receptor 1 (VMN2R1) ELISA Kit

Sign In for Pricing
View Details
Kdr (NM_010612) Mouse Tagged Lenti ORF Clone
MR224504L2 10 µg

Kdr (NM_010612) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cathepsin S (Biotin)
309412-01 50 µg

Cathepsin S (Biotin)

Sign In for Pricing
View Details
Cathepsin S (Biotin)
309412-02 100 µg

Cathepsin S (Biotin)

Sign In for Pricing
View Details
Geraniol
TRC-G367000-250G 250 g

Geraniol

Sign In for Pricing
View Details