Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human D (1A) dopamine receptor (DRD1), partial

This Recombinant Human D (1A) dopamine receptor (DRD1), partial spans the amino acid sequence from region 338-446aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dopamine D1 receptor

UniProt

P21728

Expression Region

338-446aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT1 Human Gene Knockout Kit (CRISPR)
KN401075 1 Kit

STAT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBASH3A Human qPCR Primer Pair (NM_018961)
HP225671 200 Reactions

UBASH3A Human qPCR Primer Pair (NM_018961)

Sign In for Pricing
View Details
Mix-n-StainTM CF®405M IgM Antibody Labeling Kits, 1x100ug labeling
#92561 1 Kit

Mix-n-StainTM CF®405M IgM Antibody Labeling Kits, 1x100ug labeling

Sign In for Pricing
View Details
OR4L1 (NM_001004717) Human Over-expression Lysate
LY423902 100 µg

OR4L1 (NM_001004717) Human Over-expression Lysate

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Anti-DBA Antibody
AAL-1201-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Anti-DBA Antibody

Sign In for Pricing
View Details
Human TTC19 activation kit by CRISPRa
GA110357 1 Kit

Human TTC19 activation kit by CRISPRa

Sign In for Pricing
View Details