Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human D (1A) dopamine receptor (DRD1), partial

This Recombinant Human D (1A) dopamine receptor (DRD1), partial spans the amino acid sequence from region 338-446aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dopamine D1 receptor

UniProt

P21728

Expression Region

338-446aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRNPC Human Gene Knockout Kit (CRISPR)
KN401695 1 Kit

HNRNPC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Traf3ip3 Mouse Gene Knockout Kit (CRISPR)
KN518126 1 Kit

Traf3ip3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Silver Acetate
TRC-S465040-5G 5 g

Silver Acetate

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS802175 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Tyrosine Hydroxylase (TH) Rabbit Polyclonal Antibody
TA382487 100 µL

Tyrosine Hydroxylase (TH) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DHODH (NM_001361) Human Over-expression Lysate
LY419975 100 µg

DHODH (NM_001361) Human Over-expression Lysate

Sign In for Pricing
View Details