Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial, Biotinylated

This Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial, Biotinylated spans the amino acid sequence from region 22-138aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glucose-dependent insulinotropic polypeptide receptor (GIP-R)

UniProt

P48546

Expression Region

22-138aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Gastroenterology & Hepatology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC69 (NM_015621) Human Over-expression Lysate
LS026112-100ug 100 µg

CCDC69 (NM_015621) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human SFTPC protein
MBS1562740-01 0.05 mg

Recombinant Human SFTPC protein

Sign In for Pricing
View Details
Recombinant Human SFTPC protein
MBS1562740-02 0.1 mg

Recombinant Human SFTPC protein

Sign In for Pricing
View Details
Recombinant Human SFTPC protein
MBS1562740-03 5x 0.1 mg

Recombinant Human SFTPC protein

Sign In for Pricing
View Details
Rabbit Anti-Human PTTG1 pAb
PA16454-01 50 μL

Rabbit Anti-Human PTTG1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human PTTG1 pAb
PA16454-02 100 μL

Rabbit Anti-Human PTTG1 pAb

Sign In for Pricing
View Details