Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 6A-2/6E-1 (Ly6a)

This Recombinant Mouse Lymphocyte antigen 6A-2/6E-1 (Ly6a) spans the amino acid sequence from region 27-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ly-6A.2/Ly-6E.1, Stem cell antigen 1, SCA-1, T-cell-activating protein, TAP

UniProt

P05533

Expression Region

27-112aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung: left lower lobe
CR562460 5 µg

Tissue Total RNA, Lung: left lower lobe

Sign In for Pricing
View Details
Human ZNF329 activation kit by CRISPRa
GA112538 1 Kit

Human ZNF329 activation kit by CRISPRa

Sign In for Pricing
View Details
Chloroiodoacetic Acid
TRC-C367170-2.5MG 2.5 mg

Chloroiodoacetic Acid

Sign In for Pricing
View Details
VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF740 conjugate, 0.1mg/mL
BNC741283-500 1x 500 µL

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CSTF3 Polyclonal Antibody
E-AB-65830-01 60 µL

CSTF3 Polyclonal Antibody

Sign In for Pricing
View Details
CSTF3 Polyclonal Antibody
E-AB-65830-02 120 µL

CSTF3 Polyclonal Antibody

Sign In for Pricing
View Details