Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 6A-2/6E-1 (Ly6a)

This Recombinant Mouse Lymphocyte antigen 6A-2/6E-1 (Ly6a) spans the amino acid sequence from region 27-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ly-6A.2/Ly-6E.1, Stem cell antigen 1, SCA-1, T-cell-activating protein, TAP

UniProt

P05533

Expression Region

27-112aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), CF488A conjugate, 0.1mg/mL
BNC881474-100 1x 100 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ssh3 Mouse Gene Knockout Kit (CRISPR)
KN516764 1 Kit

Ssh3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TET3 activation kit by CRISPRa
GA116350 1 Kit

Human TET3 activation kit by CRISPRa

Sign In for Pricing
View Details
PDPN (1-206) Mouse Monoclonal Antibody [Clone ID: 5E2]
AM03203PU-N 100 µL

PDPN (1-206) Mouse Monoclonal Antibody [Clone ID: 5E2]

Sign In for Pricing
View Details
Rb (RB1) Rabbit Monoclonal Antibody [Clone ID: R03-8H1]
TA421537 100 µL

Rb (RB1) Rabbit Monoclonal Antibody [Clone ID: R03-8H1]

Sign In for Pricing
View Details
OR2T8 (NM_001005522) Human Over-expression Lysate
LC423623 20 µg

OR2T8 (NM_001005522) Human Over-expression Lysate

Sign In for Pricing
View Details