Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 6A-2/6E-1 (Ly6a)

This Recombinant Mouse Lymphocyte antigen 6A-2/6E-1 (Ly6a) spans the amino acid sequence from region 27-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ly-6A.2/Ly-6E.1, Stem cell antigen 1, SCA-1, T-cell-activating protein, TAP

UniProt

P05533

Expression Region

27-112aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Golden star tunicate histocompatibility ligand secreted form Antibody (Dylight488 Conjugate)
DZ41038-Dylight488 200 µL

Anti-Golden star tunicate histocompatibility ligand secreted form Antibody (Dylight488 Conjugate)

Sign In for Pricing
View Details
Mouse RRM2B shRNA Plasmid
abx983908-01 150 µg

Mouse RRM2B shRNA Plasmid

Sign In for Pricing
View Details
Mouse RRM2B shRNA Plasmid
abx983908-02 300 µg

Mouse RRM2B shRNA Plasmid

Sign In for Pricing
View Details
Lentiviral mouse Greb1l shRNA (UAS) - Lentiviral mouse Greb1l shRNA (UAS, iRFP) (25)
GTR15183890 1 Vial

Lentiviral mouse Greb1l shRNA (UAS) - Lentiviral mouse Greb1l shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ZytoLight® SPEC ERBB2/D17S122 Dual Color Probe
ZTV-Z-2190-200 200 µL

ZytoLight® SPEC ERBB2/D17S122 Dual Color Probe

Sign In for Pricing
View Details
Recombinant Swine Adiponectin Receptor Protein 1 (ADIPOR1), N-His
AP9C946-01 1 mg

Recombinant Swine Adiponectin Receptor Protein 1 (ADIPOR1), N-His

Sign In for Pricing
View Details