Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Nucleoprotein (N)

This Recombinant Avian infectious bronchitis virus Nucleoprotein (N) spans the amino acid sequence from region 1-409aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein, NC, Protein N

UniProt

Q96598

Expression Region

1-409aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Avian infectious bronchitis virus (strain Vic S) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASGKAAGKSDAPTPIIKLGGPKPPKIGSSGNASWFQAIKAKKLNVPQPKFEGSGVPDNNNIKPSQQHGYWRRQARYKPGKSGRKPVPDAWYFYYTGTGPAADLNWGENQDGIVWVAAKGADTKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAASSRAPSREGSRGRRSGAEDDLIARAAKIIQDQQKRGSRITKAKADEMAHRRYCKRTIPPGYRVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTATLNLIPSSHACLFGSRVTPKLQPDGLHLKFEFTTVVPRDDPQFDNYVKICDQCVDGVGTRPKDDEPRPKSRSSSRPATRGNSPAPRQQRPKKEKKPKKQDDEVDKALTSDEERNNAQLEFDDEPKVINWGDSALGENEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FE65 (APBB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]
TA811192BM 100 µL

FE65 (APBB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]

Sign In for Pricing
View Details
Pipobroman
TRC-P490600-1G 1 g

Pipobroman

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501873 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
CRYAB Rabbit Monoclonal Antibody [Clone ID: 24GB6070]
TA424682 100 µL

CRYAB Rabbit Monoclonal Antibody [Clone ID: 24GB6070]

Sign In for Pricing
View Details
Hypoxanthine Monosodium Salt
TRC-H249630-5G 5 g

Hypoxanthine Monosodium Salt

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS809342 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details