Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Nucleotide-binding oligomerization domain-containing protein 2 (NOD2), partial

This Recombinant Bovine Nucleotide-binding oligomerization domain-containing protein 2 (NOD2), partial spans the amino acid sequence from region 1-191aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Caspase recruitment domain-containing protein 15

UniProt

Q6E804

Expression Region

1-191aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCAQDAFQTQRSQLVELLVSGSLEGFESILDRLLSREVLSWEDYEGLSLVGQPISHLARRLLDTIWNKGTWGCEQLTAAVREAQADSQPPELPSSWDPHSPHPARDLQSHRPAIVRRLYGHVEGVLDLTQQRGFISQYETDEIRRPIFTSSQRARRLLDLATVKANGLAAFLLQCIQELPVPLALPFEDAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr24 Mouse Gene Knockout Kit (CRISPR)
KN519345 1 Kit

Wdr24 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS502558 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
GPR56 (ADGRG1) (NM_001145771) Human Recombinant Protein
TP326861 20 µg

GPR56 (ADGRG1) (NM_001145771) Human Recombinant Protein

Sign In for Pricing
View Details
P53 (BP53-12), CF647 conjugate, 0.1mg/mL
BNC470013-100 1x 100 µL

P53 (BP53-12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Id2 (NM_010496) Mouse Tagged ORF Clone
MG200792 10 µg

Id2 (NM_010496) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mini Centrifuge BCMI-401
BCMI-401 1 Unit

Mini Centrifuge BCMI-401

Sign In for Pricing
View Details