Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat D-dopachrome decarboxylase (Ddt)

This Recombinant Rat D-dopachrome decarboxylase (Ddt) spans the amino acid sequence from region 2-118aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

D-dopachrome tautomerase

UniProt

P80254

Expression Region

2-118aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVGTAEQNRSHSSSFFKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMTFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FAM158A protein, His-tagged
FAM158A-2796H 25 µg

Recombinant Human FAM158A protein, His-tagged

Sign In for Pricing
View Details
Troponin T-Slow Skeletal Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2393499 100 µL

Troponin T-Slow Skeletal Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
FAM5C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0712907 1.0 µg DNA

FAM5C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Myoglobin (Mb) Antibody
ND-R0315 1 Each

Myoglobin (Mb) Antibody

Sign In for Pricing
View Details
Methyl 6- (bromomethyl) -2,3-difluorobenzoate
PC110426-01 100 mg

Methyl 6- (bromomethyl) -2,3-difluorobenzoate

Sign In for Pricing
View Details
Methyl 6- (bromomethyl) -2,3-difluorobenzoate
PC110426-02 250 mg

Methyl 6- (bromomethyl) -2,3-difluorobenzoate

Sign In for Pricing
View Details