Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interleukin-11 (Il11), Biotinylated

This Recombinant Rat Interleukin-11 (Il11), Biotinylated spans the amino acid sequence from region 22-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-11

UniProt

Q99MF5

Expression Region

22-199aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D4 WellRed Dye Beckman 200 nmol scale
26-6578-02 1/Each

D4 WellRed Dye Beckman 200 nmol scale

Sign In for Pricing
View Details
Goose Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 3B (SMEK2) ELISA Kit
MBS9393183 Inquire

Goose Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 3B (SMEK2) ELISA Kit

Sign In for Pricing
View Details
C9orf40 sgRNA CRISPR Lentivector set (Human)
K0266101 3x 1.0 µg

C9orf40 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
EZR (Ezrin, Cytovillin, Villin-2, p81, VIL2, CVIL, CVL, DKFZp762H157, FLJ26216, MGC1584) (MaxLight 550)
126531-ML550 100 µL

EZR (Ezrin, Cytovillin, Villin-2, p81, VIL2, CVIL, CVL, DKFZp762H157, FLJ26216, MGC1584) (MaxLight 550)

Sign In for Pricing
View Details
Ciao1 (NM_001008766) Rat Untagged Clone
RN214206 10 µg

Ciao1 (NM_001008766) Rat Untagged Clone

Sign In for Pricing
View Details
Xanthan gum
sc-296703 100 g

Xanthan gum

Sign In for Pricing
View Details