Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Excitatory amino acid transporter 1 (SLC1A3), partial

This Recombinant Human Excitatory amino acid transporter 1 (SLC1A3), partial spans the amino acid sequence from region 146-236aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent glutamate/aspartate transporter 1, GLAST-1, Solute carrier family 1 member 3

UniProt

P43003

Expression Region

146-236aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Ly6/PLAUR domain containing protein 1 (LYPD1) ELISA Kit
GTR10318735 96 Well

Rabbit Ly6/PLAUR domain containing protein 1 (LYPD1) ELISA Kit

Sign In for Pricing
View Details
REEP1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
38785126 3x 1.0µg DNA

REEP1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
ASXL1 Antibody (Center) Blocking peptide
MBS9218168-01 0.5 mg

ASXL1 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
ASXL1 Antibody (Center) Blocking peptide
MBS9218168-02 5x 0.5 mg

ASXL1 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
XRCC2 Rabbit Polyclonal Antibody (APC-Cy7)
orb2381001 100 µL

XRCC2 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Recombinant Mouse Betacellulin/BTC Protein (Trx Tag)
PDEM100168-01 20 µg

Recombinant Mouse Betacellulin/BTC Protein (Trx Tag)

Sign In for Pricing
View Details