Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated

This Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated spans the amino acid sequence from region 143-288aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Basic fibroblast growth factor, bFGFHeparin-binding growth factor 2, HBGF-2

UniProt

P09038

Expression Region

143-288aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rel B (RELB) (NM_006509) Human Recombinant Protein
TP307006M 100 µg

Rel B (RELB) (NM_006509) Human Recombinant Protein

Sign In for Pricing
View Details
HSD17B11 Mouse Monoclonal Antibody [Clone ID: OTI13F7]
CF816056 100 µg

HSD17B11 Mouse Monoclonal Antibody [Clone ID: OTI13F7]

Sign In for Pricing
View Details
3-chloro-5-fluoro-4-hydroxybenzoic Acid
TRC-C375053-5MG 5 mg

3-chloro-5-fluoro-4-hydroxybenzoic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS642604 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
CXorf26 (PBDC1) (NM_001300888) Human Tagged ORF Clone
RG236764 10 µg

CXorf26 (PBDC1) (NM_001300888) Human Tagged ORF Clone

Sign In for Pricing
View Details
1-Bromo-2-phenoxyethane
TRC-B686385-50G 50 g

1-Bromo-2-phenoxyethane

Sign In for Pricing
View Details