Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated
This Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated spans the amino acid sequence from region 143-288aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Basic fibroblast growth factor, bFGFHeparin-binding growth factor 2, HBGF-2
UniProt
P09038
Expression Region
143-288aa
Tag
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cardiovascular Research; Stem Cell & Developmental Biology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
64.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NB100-64754 0.125 mg
Mouse Monoclonal Coronavirus Antibody (FIPV3-70)
Sign In for Pricing
View Details 
GTR15103056 1 Vial
Lentiviral human EVX1 shRNA (UAS) - Lentiviral human EVX1 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details TL318815 1 Kit
Stathmin 1 (STMN1) Human shRNA Plasmid Kit (Locus ID 3925)
Sign In for Pricing
View Details