Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein DEK (DEK) (S375SLEH), partial

This Recombinant Human Protein DEK (DEK) (S375SLEH), partial spans the amino acid sequence from region 309-375aa (S375SLEH) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P35659

Expression Region

309-375aa (S375SLEH)

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKELISLEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGM4 Rabbit Polyclonal Antibody (APC)
orb2991790 100 µg

TGM4 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Porcine Soluble tumor necrosis factor-related apoptosis inducing ligand ELISA Kit
GTR10345320 96 Well

Porcine Soluble tumor necrosis factor-related apoptosis inducing ligand ELISA Kit

Sign In for Pricing
View Details
EJM1 AAV Vector (Human) (CMV)
19185101 1 µg

EJM1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Kcna4 Mouse Monoclonal Antibody [Clone ID: K13/31]
75-010 100 µL

Kcna4 Mouse Monoclonal Antibody [Clone ID: K13/31]

Sign In for Pricing
View Details
Mouse Monoclonal SNRPB2 Antibody (OTI2A5) [Alexa Fluor 647]
NBP2-74260AF647 0.1 mL

Mouse Monoclonal SNRPB2 Antibody (OTI2A5) [Alexa Fluor 647]

Sign In for Pricing
View Details
ZNF408 Antibody / PRDM17
V9249SAF-100UG 100 µg

ZNF408 Antibody / PRDM17

Sign In for Pricing
View Details