Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein DEK (DEK) (S375SLEH), partial

This Recombinant Human Protein DEK (DEK) (S375SLEH), partial spans the amino acid sequence from region 309-375aa (S375SLEH) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P35659

Expression Region

309-375aa (S375SLEH)

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKELISLEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTIP2 (BCL11B) (NM_138576) Human Tagged ORF Clone
RG211430 10 µg

CTIP2 (BCL11B) (NM_138576) Human Tagged ORF Clone

Sign In for Pricing
View Details
Fmoc-Val-Thr(psi(Me,Me)pro)-OH
MBS5799678 Inquire

Fmoc-Val-Thr(psi(Me,Me)pro)-OH

Sign In for Pricing
View Details
TRIP13 Human shRNA Plasmid Kit (Locus ID 9319)
TR308634 1 Kit

TRIP13 Human shRNA Plasmid Kit (Locus ID 9319)

Sign In for Pricing
View Details
Lentiviral human KRTAP27-1 sgRNA gene knockout kit - Lentiviral human KRTAP27-1 sgRNA gene knockout kit (100)
GTR15374650 1 Vial

Lentiviral human KRTAP27-1 sgRNA gene knockout kit - Lentiviral human KRTAP27-1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Human Bence-Jones Protein BJP ELISA Kit
BG-HUM10366 1 Each

Human Bence-Jones Protein BJP ELISA Kit

Sign In for Pricing
View Details
ZNF364   monoclonal antibody
MB10254 50ul

ZNF364 monoclonal antibody

Sign In for Pricing
View Details