Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein DEK (DEK) (S375SLEH), partial

This Recombinant Human Protein DEK (DEK) (S375SLEH), partial spans the amino acid sequence from region 309-375aa (S375SLEH) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P35659

Expression Region

309-375aa (S375SLEH)

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKELISLEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HHIP Protein
E30P1499 20 µg

Recombinant Human HHIP Protein

Sign In for Pricing
View Details
C21orf117 3'UTR Luciferase Stable Cell Line
TU003286 1.0 mL

C21orf117 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Diacylglycerol Kinase Inhibitor I
MBS539901-01 50 mg

Diacylglycerol Kinase Inhibitor I

Sign In for Pricing
View Details
Diacylglycerol Kinase Inhibitor I
MBS539901-02 5x 50 mg

Diacylglycerol Kinase Inhibitor I

Sign In for Pricing
View Details
DGCR6L (NM_033257) Human Recombinant Protein
E45H42108M5 20 µg

DGCR6L (NM_033257) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Cardiac Myoglobin
7720-01 1 mg

Rabbit Cardiac Myoglobin

Sign In for Pricing
View Details