Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granzyme K (Gzmk)

This Recombinant Mouse Granzyme K (Gzmk) spans the amino acid sequence from region 26-263aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

O35205

Expression Region

26-263aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGREVQPHSRPFMASIQYRSKHICGGVLIHPQWVLTAAHCYSWFPRGHSPTVVLGAHSLSKNEPMKQTFEIKKFIPFSRLQSGSASHDIMLIKLRTAAELNKNVQLLHLGSKNYLRDGTKCQVTGWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNHKPVITKDMICAGDARGQKDSCKGDSGGPLICKGIFHALVSQGYKCGIAKKPGIYTLLTKKYQTWIKSKLAPSRAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P55;50 EBV-Early Antigen (1108-1), CF405S conjugate, 0.1mg/mL
BNC040103-100 1x 100 µL

P55;50 EBV-Early Antigen (1108-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hnf4a Rabbit Polyclonal Antibody
TA377152 100 µL

Hnf4a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLCN1 (NM_000083) Human Over-expression Lysate
LY424940 100 µg

CLCN1 (NM_000083) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant PAX8 Monoclonal Antibody
AN301620L-01 50 µL

Recombinant PAX8 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant PAX8 Monoclonal Antibody
AN301620L-02 100 µL

Recombinant PAX8 Monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS702198 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details