Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granzyme K (Gzmk)

This Recombinant Mouse Granzyme K (Gzmk) spans the amino acid sequence from region 26-263aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

O35205

Expression Region

26-263aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGREVQPHSRPFMASIQYRSKHICGGVLIHPQWVLTAAHCYSWFPRGHSPTVVLGAHSLSKNEPMKQTFEIKKFIPFSRLQSGSASHDIMLIKLRTAAELNKNVQLLHLGSKNYLRDGTKCQVTGWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNHKPVITKDMICAGDARGQKDSCKGDSGGPLICKGIFHALVSQGYKCGIAKKPGIYTLLTKKYQTWIKSKLAPSRAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp6v0c (NM_009729) Mouse Tagged ORF Clone
MG201148 10 µg

Atp6v0c (NM_009729) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Spef2 Mouse Gene Knockout Kit (CRISPR)
KN516590 1 Kit

Spef2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Hydroxyquinoline
TRC-H953140-5G 5 g

3-Hydroxyquinoline

Sign In for Pricing
View Details
Cell Meter™ Flow Cytometric Calcium Assay Kit
36310-AAT 100 Tests

Cell Meter™ Flow Cytometric Calcium Assay Kit

Sign In for Pricing
View Details
P57 / KIP2 (KP10), 1mg/mL
BNUM0879-50 1x 50 µL

P57 / KIP2 (KP10), 1mg/mL

Sign In for Pricing
View Details
Biochanin A-D3
TRC-B387259-5MG 5 mg

Biochanin A-D3

Sign In for Pricing
View Details