Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrroline-5-carboxylate reductase (proC)

This Recombinant Pyrroline-5-carboxylate reductase (proC) spans the amino acid sequence from region 1-295aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P5C reductase; P5CR; PCA reductase

UniProt

P9WHU7

Expression Region

1-295aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLFGMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVAERMPDRANYLAQTYSVLVTSAADAVENATFVVVAVKPADVEPVIADLANATAAAENDSAEQVFVTVVAGITIAYFESKLPAGTPVVRAMPNAAALVGAGVTALAKGRFVTPQQLEEVSALFDAVGGVLTVPESQLDAVTAVSGSGPAYFFLLVEALVDAGVGVGLSRQVATDLAAQTMAGSAAMLLERMEQDQGGANGELMGLRVDLTASRLRAAVTSPGGTTAAALRELERGGFRMAVDAAVQAAKSRSEQLRITPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS17P15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2037207 1.0 µg DNA

RPS17P15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
MTND4P5 Protein Vector (Human) (pPB-C-His)
PV102546 500 ng

MTND4P5 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CGA Protein Vector (Mouse) (pPM-C-His)
PV165021 500 ng

CGA Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
PCDH11X Protein Vector (Human) (pPM-C-HA)
36104021 500 ng

PCDH11X Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal Apolipoprotein A5 Antibody (4H8H8E2) [CoraFluor 1]
NB110-57307CL1 0.1 mL

Mouse Monoclonal Apolipoprotein A5 Antibody (4H8H8E2) [CoraFluor 1]

Sign In for Pricing
View Details
GNG7 Rabbit Polyclonal Antibody
orb411637-01 100 µL

GNG7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details