Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Superoxide dismutase [Cu-Zn] (sodC)

This Recombinant Mycobacterium tuberculosis Superoxide dismutase [Cu-Zn] (sodC) spans the amino acid sequence from region 33-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P9WGE8

Expression Region

33-240aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSSPQHASTVPGTTPSIWTGSPAPSGLSGHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTIATTGVGKLTPGFHGLHIHQVGKCEPNSVAPTGGAPGNFLSAGGHYHVPGHTGTPASGDLASLQVRGDGSAMLVTTTDAFTMDDLLSGAKTAIIIHAGADNFANIPPERYVQVNGTPGPDETTLTTGDAGKRVACGVIGSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig ASMA ELISA Kit
EGA0443 96 Tests

Guinea Pig ASMA ELISA Kit

Sign In for Pricing
View Details
CASC3 (Y181) (Cancer Susceptibility Candidate Gene 3 Protein Homolog, Metastatic Lymph Node Protein 51 Homolog, Protein MLN 51 Homolog, Protein Barentsz, Btz, mBtz, Protein CASC3, Mln51) (AP) discontinued
C2081-30B-AP 200 µL

CASC3 (Y181) (Cancer Susceptibility Candidate Gene 3 Protein Homolog, Metastatic Lymph Node Protein 51 Homolog, Protein MLN 51 Homolog, Protein Barentsz, Btz, mBtz, Protein CASC3, Mln51) (AP) discontinued

Sign In for Pricing
View Details
HKDC1 (NM_025130) Human Tagged ORF Clone
RG221178 10 µg

HKDC1 (NM_025130) Human Tagged ORF Clone

Sign In for Pricing
View Details
ARF4 Rabbit Polyclonal Antibody
E10G34332 100 µL

ARF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5- (Methoxycarbonyl) -1H-indazole-3-carboxylic acid
XGB80453-01 100 mg

5- (Methoxycarbonyl) -1H-indazole-3-carboxylic acid

Sign In for Pricing
View Details
5- (Methoxycarbonyl) -1H-indazole-3-carboxylic acid
XGB80453-02 1 g

5- (Methoxycarbonyl) -1H-indazole-3-carboxylic acid

Sign In for Pricing
View Details