Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ESX-1 secretion-associated protein EspK (espK), partial

This Recombinant ESX-1 secretion-associated protein EspK (espK), partial spans the amino acid sequence from region 21-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P9WJC1

Expression Region

21-114aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VEADEDTFYDRAQEYSQVLQRVTDVLDTCRQQKGHVFEGGLWSGGAANAANGALGANINQLMTLQDYLATVITWHRHIAGLIEQAKSDIGNNVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDA (NM_004293) Human Over-expression Lysate
LC418083 20 µg

GDA (NM_004293) Human Over-expression Lysate

Sign In for Pricing
View Details
Alpha 4 (B-5) Alexa Fluor® 546
sc-373719 AF546 200 µg/mL

Alpha 4 (B-5) Alexa Fluor® 546

Sign In for Pricing
View Details
PTGES2 Protein Lysate (Rat) with C-HA Tag
38088036 100 µg

PTGES2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Rat Hemojuvelin (HJV) ELISA Kit DIY Materials
MBS2089223-01 5x 96 Tests

Rat Hemojuvelin (HJV) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Rat Hemojuvelin (HJV) ELISA Kit DIY Materials
MBS2089223-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

Rat Hemojuvelin (HJV) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Rat Hemojuvelin (HJV) ELISA Kit DIY Materials
MBS2089223-03 10x 96 Tests

Rat Hemojuvelin (HJV) ELISA Kit DIY Materials

Sign In for Pricing
View Details