Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Hemolysin E, chromosomal (hlyE), partial

This Recombinant Escherichia coli Hemolysin E, chromosomal (hlyE), partial spans the amino acid sequence from region 2-182aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytotoxin ClyA, Hemolysis-inducing protein, Latent pore-forming 34 kDa hemolysin, Silent hemolysin SheA

UniProt

P77335

Expression Region

2-182aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TEIVADKTVEVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASVLVGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVLDDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal OR2C3 Antibody [Alexa Fluor 488]
NBP2-97856AF488 0.1 mL

Rabbit Polyclonal OR2C3 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
GPSM1 (NM_001145638) Human Mass Spec Standard
PH327680 10 µg

GPSM1 (NM_001145638) Human Mass Spec Standard

Sign In for Pricing
View Details
PAFAH1B1 Protein (N-His, Human)
P506857 100 µg

PAFAH1B1 Protein (N-His, Human)

Sign In for Pricing
View Details
SYNPO2L Polyclonal Antibody
E912691 100 µL

SYNPO2L Polyclonal Antibody

Sign In for Pricing
View Details
Vegfc Rabbit Polyclonal Antibody (Cy3)
orb2585783 100 µg

Vegfc Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Clasto-Lactacystin b-lactone
GK6045-200ug 200 µg

Clasto-Lactacystin b-lactone

Sign In for Pricing
View Details