Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-1 alpha (IL1A), Biotinylated

This Recombinant Human Interleukin-1 alpha (IL1A), Biotinylated spans the amino acid sequence from region 113-271aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hematopoietin-1

UniProt

P01583

Expression Region

113-271aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Importin 13 (IPO13) (NM_014652) Human Tagged Lenti ORF Clone
RC201577L1 10 µg

Importin 13 (IPO13) (NM_014652) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human PD1 protein
orb706873-01 10 µg

Human PD1 protein

Sign In for Pricing
View Details
Human PD1 protein
orb706873-02 50 µg

Human PD1 protein

Sign In for Pricing
View Details
Human PD1 protein
orb706873-03 500 µg

Human PD1 protein

Sign In for Pricing
View Details
Mouse Monoclonal epithelial Sodium Channel gamma Antibody (3c7) [Alexa Fluor 532]
NBP2-41371AF532 0.1 mL

Mouse Monoclonal epithelial Sodium Channel gamma Antibody (3c7) [Alexa Fluor 532]

Sign In for Pricing
View Details
PI3Kδ/γ-IN-3
T63078-01 25 mg

PI3Kδ/γ-IN-3

Sign In for Pricing
View Details