Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zika virus Genome polyprotein, partial

This Recombinant Zika virus Genome polyprotein, partial spans the amino acid sequence from region 1415-1463aa+GGGGSGGGG+1499-1668aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q32ZE1

Expression Region

1415-1463aa+GGGGSGGGG+1499-1668aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Zika virus (ZIKV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMRGGGGSGGGGSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERARNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tas2r117 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
46153114 3x 1.0 µg

Tas2r117 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
SARS-CoV-2 NSP10/GFL Protein (N-His, Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) )
P508051 100 µg

SARS-CoV-2 NSP10/GFL Protein (N-His, Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) )

Sign In for Pricing
View Details
Mouse Transcription factor BTF3, Btf3 ELISA KIT
ELI-25125m 96 Tests

Mouse Transcription factor BTF3, Btf3 ELISA KIT

Sign In for Pricing
View Details
Anti-Human CD370/CLEC9A Antibody (R2CHCL10), PerCP
MBS1585311-01 50 Tests

Anti-Human CD370/CLEC9A Antibody (R2CHCL10), PerCP

Sign In for Pricing
View Details
Anti-Human CD370/CLEC9A Antibody (R2CHCL10), PerCP
MBS1585311-02 100 Tests

Anti-Human CD370/CLEC9A Antibody (R2CHCL10), PerCP

Sign In for Pricing
View Details
Anti-Human CD370/CLEC9A Antibody (R2CHCL10), PerCP
MBS1585311-03 5x 100 Tests

Anti-Human CD370/CLEC9A Antibody (R2CHCL10), PerCP

Sign In for Pricing
View Details