Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lens culinaris Lectin, partial

This Recombinant Lens culinaris Lectin, partial spans the amino acid sequence from region 31-210aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P02870

Expression Region

31-210aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Lens culinaris (Lentil) (Cicer lens)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TETTSFSITKFSPDQKNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADEFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB11FIP5 antibody
70R-9316 50 ug

RAB11FIP5 antibody

Sign In for Pricing
View Details
FAS Ligand Antibody (ready-to-use)
GWB-23414A 7 mL

FAS Ligand Antibody (ready-to-use)

Sign In for Pricing
View Details
NPAT Protein Vector (Mouse) (pPM-C-HA)
PV206220 500 ng

NPAT Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse CT ELISA Kit
EMC0411 96 Tests

Mouse CT ELISA Kit

Sign In for Pricing
View Details
CCL5 Recombinant Protein
91-049 0.05 mg

CCL5 Recombinant Protein

Sign In for Pricing
View Details
Collagen autoantibody (CLA) Human ELISA Kit
C3889 96 Tests

Collagen autoantibody (CLA) Human ELISA Kit

Sign In for Pricing
View Details